PPT1 anticorps (C-Term)

N° du produit ABIN3043357

Détail du produit anti-PPT1 anticorps

Antigène: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Épitope: AA 191-224, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPT1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Palmitoyl-protein thioesterase 1(PPT1) detection. Tested with WB, IHC-P in Human,Rat.

Séquence: KEDVYRNHSI FLADINQERG INESYKKNLM ALKK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Palmitoyl-protein thioesterase 1(PPT1) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: palmitoyl-protein thioesterase 1
Protein Name: Palmitoyl-protein thioesterase 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PPT1

Antigène: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Autre désignation: PPT1 (PPT1 Produits)

Synonymes: anticorps CLN1, anticorps INCL, anticorps PPT, anticorps 9530043G02Rik, anticorps AA960502, anticorps C77813, anticorps D4Ertd184e, anticorps Ppt, anticorps wu:fj17f04, anticorps zgc:63969, anticorps PPT-1, anticorps ppt1, anticorps palmitoyl-protein thioesterase 1, anticorps Palmitoyl-protein thioesterase 1, anticorps palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile), anticorps palmitoyl-protein thioesterase 1 L homeolog, anticorps PPT1, anticorps MGYG_00692, anticorps Ppt1, anticorps ppt-1, anticorps ppt1, anticorps ppt1.L

Sujet: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

Synonyms: Ceroid palmitoyl palmitoyl protein thioesterase 1 antibody|CLN1 antibody|EC 3.1.2.22 antibody|INCL antibody|Palmitoyl protein hydrolase 1 antibody|Palmitoyl protein thioesterase 1 antibody|Palmitoyl-protein hydrolase 1 antibody|Palmitoyl-protein thioesterase 1 antibody|PPT antibody|PPT-1 antibody|PPT1 antibody|PPT1_HUMAN antibody

ID gène: 5538

UniProt: P50897

Pathways: SARS-CoV-2 Protein Interactome