MLH1 anticorps (C-Term)

N° du produit ABIN3043404

Détail du produit anti-MLH1 anticorps

Antigène: MLH1 (MutL Homolog 1 (MLH1))

Épitope: AA 722-756, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MLH1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for DNA mismatch repair protein Mlh1(MLH1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: KALRSHILPP KHFTEDGNIL QLANLPDLYK VFERC

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for DNA mismatch repair protein Mlh1(MLH1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: mutL homolog 1
Protein Name: DNA mismatch repair protein Mlh1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1 (722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC), different from the related mouse sequence by three amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur MLH1

Antigène: MLH1 (MutL Homolog 1 (MLH1))

Autre désignation: MLH1 (MLH1 Produits)

Synonymes: anticorps CG11482, anticorps Dmel\\CG11482, anticorps dmlh-1, anticorps dmlh1, anticorps zgc:66301, anticorps MLH1, anticorps LOC100232198, anticorps 1110035C23Rik, anticorps AI317206, anticorps AI325952, anticorps AI561766, anticorps COCA2, anticorps FCC2, anticorps HNPCC, anticorps HNPCC2, anticorps hMLH1, anticorps mutL homolog 1, anticorps CG11482 gene product from transcript CG11482-RB, anticorps mutL homolog 1 S homeolog, anticorps mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli), anticorps DNA mismatch repair protein Mlh1, anticorps MLH1, anticorps Mlh1, anticorps mlh1.S, anticorps mlh1, anticorps LOC588545

Sujet: MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described, but their full-length natures have not been determined.

Synonyms: COCA 2 antibody|COCA2 antibody|DNA mismatch repair protein Mlh1 antibody|FCC 2 antibody|FCC2 antibody|hMLH 1 antibody|hMLH1 antibody| HNPCC 2 antibody|HNPCC antibody|HNPCC2 antibody|MGC5172 antibody|MLH 1 antibody|MLH1 antibody|MLH1_HUMAN antibody|MutL homolog 1 (E. coli) antibody|MutL homolog 1 antibody|MutL homolog 1 colon cancer nonpolyposis type 2 antibody|MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) antibody|MutL protein homolog 1 antibody|MutL, E. coli, homolog of, 1 antibody

ID gène: 4292

UniProt: P40692

Pathways: Réparation de l'ADN, Production of Molecular Mediator of Immune Response