LIM Domain Kinase 1 anticorps (C-Term)

N° du produit ABIN3043411

Détail du produit anti-LIM Domain Kinase 1 anticorps

Antigène: LIM Domain Kinase 1 (LIMK1)

Épitope: AA 599-634, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIM Domain Kinase 1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for LIM domain kinase 1(LIMK1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: KLEHWLETLR MHLAGHLPLG PQLEQLDRGF WETYRR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for LIM domain kinase 1(LIMK1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: LIM domain kinase 1
Protein Name: LIM domain kinase 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-LIM Domain Kinase 1 (ABIN3043411)

Zhang, Gan, Zhou: "Immunohistochemical investigation of the correlation between LIM kinase 1 expression and development and progression of human ovarian carcinoma." dans: The Journal of international medical research, Vol. 40, Issue 3, pp. 1067-73, (2013) (PubMed).

Détails sur LIM Domain Kinase 1

Antigène: LIM Domain Kinase 1 (LIMK1)

Autre désignation: LIMK1 (LIMK1 Produits)

Synonymes: anticorps limk1, anticorps xlimk1, anticorps GB16654, anticorps LIMK1, anticorps LIMK, anticorps LIMK-1, anticorps LIM domain kinase 1, anticorps LIM domain kinase 1a, anticorps LIM domain kinase 1 L homeolog, anticorps LIM-domain containing, protein kinase, anticorps LIMK1, anticorps limk1a, anticorps limk1, anticorps CpipJ_CPIJ000717, anticorps LOC413152, anticorps Limk1, anticorps limk1.L

Sujet: LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.

Synonyms: EC 2.7.11.1 antibody|LIM domain kinase 1 antibody|LIM motif-containing protein kinase antibody|LIMK antibody|LIMK-1 antibody|limk1 antibody|LIMK1_HUMAN antibody

ID gène: 3984

UniProt: P53667

Pathways: Caspase Cascade in Apoptosis, Regulation of Cell Size, CXCR4-mediated Signaling Events