LOXL2 anticorps (C-Term)

N° du produit ABIN3043464

Détail du produit anti-LOXL2 anticorps

Antigène: LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))

Épitope: AA 739-770, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LOXL2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Lysyl oxidase homolog 2(LOXL2) detection. Tested with WB in Human,Mouse,Rat.

Séquence: HRIWMYNCHI GGSFSEETEK KFEHFSGLLN NQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Lysyl oxidase homolog 2(LOXL2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: lysyl oxidase-like 2
Protein Name: Lysyl oxidase homolog 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human LOXL2 (739-770aa HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ), different from the related mouse and rat sequences by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur LOXL2

Antigène: LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))

Autre désignation: LOXL2 (LOXL2 Produits)

Synonymes: anticorps LOR2, anticorps WS9-14, anticorps CG4402, anticorps Dmel\\CG4402, anticorps Dmloxl-2, anticorps dmlox-2, anticorps 1110004B06Rik, anticorps 4930526G11Rik, anticorps 9430067E15Rik, anticorps GB13360, anticorps lox2-like, anticorps LOXL2, anticorps lor2, anticorps loxl-2, anticorps ws9-14, anticorps im:7136137, anticorps si:dkeyp-32b1.1, anticorps wu:fk12g04, anticorps zgc:158414, anticorps lysyl oxidase like 2, anticorps lysyl oxidase-like 2, anticorps lysyl oxidase homolog 4, anticorps lysyl oxidase like 2 L homeolog, anticorps lysyl oxidase-like 2b, anticorps LOXL2, anticorps lox2, anticorps Loxl2, anticorps LOC408544, anticorps loxl2.L, anticorps loxl2, anticorps loxl2b

Sujet: Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL2 can also crosslink collagen type IV and hence influence the sprouting of new blood vessels.

Synonyms: LOR 2 antibody|LOR2 antibody|LOX L2 antibody|LOXL 2 antibody|LOXL2 antibody|LOXL2_HUMAN antibody|Lysyl oxidase homolog 2 antibody| Lysyl oxidase like 2 antibody|Lysyl oxidase like protein 2 antibody|Lysyl oxidase related 2 antibody|Lysyl oxidase related protein 2 antibody|Lysyl oxidase related protein WS9 14 antibody|Lysyl oxidase-like protein 2 antibody|Lysyl oxidase-related protein 2 antibody| Lysyl oxidase-related protein WS9-14 antibody|WS9 14 antibody

ID gène: 4017

UniProt: Q9Y4K0

Pathways: Chromatin Binding