Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

RAGE anticorps (N-Term)

AGER Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043529
  • Antigène Voir toutes RAGE (AGER) Anticorps
    RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))
    Épitope
    • 19
    • 16
    • 16
    • 11
    • 11
    • 9
    • 8
    • 7
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 91-120, N-Term
    Reactivité
    • 142
    • 81
    • 63
    • 8
    • 6
    • 5
    • 4
    • 3
    • 2
    • 2
    • 1
    Humain, Souris, Rat
    Hôte
    • 136
    • 11
    • 4
    • 2
    • 1
    Lapin
    Clonalité
    • 130
    • 23
    • 1
    Polyclonal
    Conjugué
    • 70
    • 11
    • 10
    • 9
    • 8
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Cet anticorp RAGE est non-conjugé
    Application
    • 126
    • 66
    • 49
    • 34
    • 27
    • 26
    • 23
    • 11
    • 8
    • 8
    • 7
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Advanced glycosylation end product-specific receptor (AGER) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    IQDEGIFRCQ AMNRNGKETK SNYRVRVYQI
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Advanced glycosylation end product-specific receptor (AGER) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: advanced glycosylation end product-specific receptor
    Protein Name: Advanced glycosylation end product-specific receptor
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product AGER Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Li, Lu, Zhang, Zhou, Chen: "Increased Serum High Mobility Group Box 1 (HMGB1) Concentration and the Altered Expression of HMGB1 and Its Receptor Advanced Glycation Endproducts in Pemphigus." dans: Annals of dermatology, Vol. 29, Issue 1, pp. 121-123, (2017) (PubMed).

    Wang, He, Wang, Yuan, Guo, Chai, Wang, Hu, Zhang: "Neuroprotective effect of salvianolate lyophilized injection against cerebral ischemia in type 1 diabetic rats." dans: BMC complementary and alternative medicine, Vol. 17, Issue 1, pp. 258, (2017) (PubMed).

    Yang, Gao, Wu, Yu, Li, Meng, Li, Yan, Jin: "Epigallocatechin-3-gallate attenuates neointimal hyperplasia in a rat model of carotid artery injury by inhibition of high mobility group box 1 expression." dans: Experimental and therapeutic medicine, Vol. 14, Issue 3, pp. 1975-1982, (2017) (PubMed).

    Yu, Yu, Liu, Yu, Liu, Liu, Su, Jiang, Chen: "Ethyl pyruvate attenuated coxsackievirus B3-induced acute viral myocarditis by suppression of HMGB1/RAGE/NF-ΚB pathway." dans: SpringerPlus, Vol. 5, pp. 215, (2016) (PubMed).

    Qin, Niu, Wang, Xu, Qiao, Gu: "Heparanase induced by advanced glycation end products (AGEs) promotes macrophage migration involving RAGE and PI3K/AKT pathway." dans: Cardiovascular diabetology, Vol. 12, pp. 37, (2013) (PubMed).

    Liu, Wang, Feng, Ma, Fu, Song, Jia, Ma: "Hypoglycemic and antioxidant activities of paeonol and its beneficial effect on diabetic encephalopathy in streptozotocin-induced diabetic rats." dans: Journal of medicinal food, Vol. 16, Issue 7, pp. 577-86, (2013) (PubMed).

    Wang, Zhang, Liu, Cui, Yang, Li, Du: "Tanshinone II A down-regulates HMGB1, RAGE, TLR4, NF-kappaB expression, ameliorates BBB permeability and endothelial cell function, and protects rat brains against focal ischemia." dans: Brain research, Vol. 1321, pp. 143-51, (2010) (PubMed).

    Wang, Zhang, Liu, Yang, Cui, Li: "Atorvastatin protects rat brains against permanent focal ischemia and downregulates HMGB1, HMGB1 receptors (RAGE and TLR4), NF-kappaB expression." dans: Neuroscience letters, Vol. 471, Issue 3, pp. 152-6, (2010) (PubMed).

  • Antigène
    RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))
    Autre désignation
    AGER (AGER Produits)
    Synonymes
    anticorps RAGE, anticorps AGER, anticorps advanced glycosylation end-product specific receptor, anticorps advanced glycosylation end product-specific receptor, anticorps MAPK/MAK/MRK overlapping kinase, anticorps AGER, anticorps Ager, anticorps LOC719012
    Sujet
    The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.

    Synonyms: Advanced glycosylation end product-specific receptor antibody|AGER antibody|MGC2235 antibody|MGC22357 antibody|RAGE_HUMAN antibody|Receptor for advanced glycation endproducts antibody|Receptor for advanced glycosylation end products antibody
    ID gène
    177
    UniProt
    Q15109
    Pathways
    Carbohydrate Homeostasis, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, S100 Proteins
Vous êtes ici:
Support technique