TREX1 anticorps (Middle Region)

N° du produit ABIN3043537

Détail du produit anti-TREX1 anticorps

Antigène: TREX1 (three Prime Repair Exonuclease 1 (TREX1))

Épitope: AA 156-185, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TREX1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.

Séquence: DDNLANLLLA FLRRQPQPWC LVAHNGDRYD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.
Gene Name: three prime repair exonuclease 1
Protein Name: Three-prime repair exonuclease 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human TREX1 (156-185aa DDNLANLLLAFLRRQPQPWCLVAHNGDRYD), different from the related mouse sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur TREX1

Antigène: TREX1 (three Prime Repair Exonuclease 1 (TREX1))

Autre désignation: TREX1 (TREX1 Produits)

Synonymes: anticorps AGS1, anticorps CRV, anticorps DRN3, anticorps HERNS, anticorps 1661, anticorps AU041952, anticorps RGD1309596, anticorps three prime repair exonuclease 1, anticorps CpipJ_CPIJ012074, anticorps Tsp_03749, anticorps TREX1, anticorps Trex1

Sujet: Three prime repair exonuclease 1 is an enzyme that in humans is encoded by the TREX1 gene. This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.

Synonyms: 3' 5' exonuclease TREX1 antibody|3' repair exonuclease 1 antibody|AGS1 antibody|AGS5 antibody|CRV antibody|Deoxyribonuclease III, dnaQ/mutD (E. coli) like antibody|DKFZp434J0310 antibody|DNase III antibody|DRN3 antibody|HERNS antibody|Three prime repair exonuclease 1 antibody|TREX1 antibody

ID gène: 11277

Pathways: Apoptose