PAX2A anticorps (C-Term)
-
- Antigène Voir toutes PAX2A Anticorps
- PAX2A (Paired Box Gene 2a (PAX2A))
-
Épitope
- AA 248-282, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAX2A est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Paired box protein Pax-2(PAX2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- RKHLRADTFT QQQLEALDRV FERPSYPDVF QASEH
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Paired box protein Pax-2(PAX2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: paired box 2
Protein Name: Paired box protein Pax-2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Pax2 (248-282aa RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product PAX2A Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Matrine suppresses the migration and invasion of NSCLC cells by inhibiting PAX2-induced epithelial-mesenchymal transition." dans: OncoTargets and therapy, Vol. 10, pp. 5209-5217, (2017) (PubMed).
: "
-
Matrine suppresses the migration and invasion of NSCLC cells by inhibiting PAX2-induced epithelial-mesenchymal transition." dans: OncoTargets and therapy, Vol. 10, pp. 5209-5217, (2017) (PubMed).
-
- Antigène
- PAX2A (Paired Box Gene 2a (PAX2A))
- Autre désignation
- PAX2 (PAX2A Produits)
- Synonymes
- anticorps PAPRS, anticorps Opdc, anticorps Pax-2, anticorps Pax-2a, anticorps XPax-2, anticorps XPax2, anticorps pax-2, anticorps pax2, anticorps xPax-2a, anticorps PAXZF-B, anticorps cb378, anticorps noi, anticorps pax-b, anticorps pax2.1, anticorps pax2a1, anticorps pax[zf-b], anticorps paxb, anticorps pax2.2, anticorps paired box 2, anticorps paired box 2 L homeolog, anticorps paired box 2a, anticorps paired box 2b, anticorps PAX2, anticorps Pax2, anticorps pax2.L, anticorps pax2a, anticorps pax2b
- Sujet
-
Paired box gene 2, also known as PAX2, is a protein which in humans is encoded by the PAX2 gene. This gene is mapped to 10q24. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Synonyms: Paired box 2 antibody|Paired box gene 2 antibody|paired box homeotic gene 2 antibody|paired box protein 2 antibody|Paired box protein Pax 2 antibody|Paired box protein Pax-2 antibody|Paired box protein Pax2 antibody|Pax 2 antibody - ID gène
- 5076
- UniProt
- Q02962
- Pathways
- Carbohydrate Homeostasis, Stem Cell Maintenance, Tube Formation
-