ALDH2 anticorps (N-Term)

N° du produit ABIN3043782

Détail du produit anti-ALDH2 anticorps

Antigène: ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))

Épitope: AA 18-48, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: SAAATQAVPA PNQQPEVFCN QIFINNEWHD A

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aldehyde dehydrogenase 2 family (mitochondrial)
Protein Name: Aldehyde dehydrogenase, mitochondrial

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ALDH2

Antigène: ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))

Autre désignation: ALDH2 (ALDH2 Produits)

Synonymes: anticorps aldh2, anticorps aldh2a, anticorps zgc:63786, anticorps MGC80785, anticorps aldh-e2, anticorps aldhi, anticorps aldm, anticorps rf2b, anticorps ALDH-E2, anticorps ALDHI, anticorps ALDM, anticorps Ahd-5, anticorps Ahd5, anticorps aldehyde dehydrogenase 2 family (mitochondrial), tandem duplicate 1, anticorps aldehyde dehydrogenase 2 family (mitochondrial) L homeolog, anticorps aldehyde dehydrogenase 2 family (mitochondrial), anticorps aldehyde dehydrogenase 2, anticorps aldehyde dehydrogenase, anticorps aldehyde dehydrogenase (NAD(+)), anticorps hypothetical protein, anticorps aldehyde dehydrogenase 2, mitochondrial, anticorps aldh2.1, anticorps aldh2.L, anticorps aldh2, anticorps ALDH2, anticorps RHA1_RS43090, anticorps aldH2, anticorps OE_RS03015, anticorps Aldh2

Sujet: ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60 % , most likely through its inhibitory effect on the formation of cytotoxic aldehydes.

Synonyms: Acetaldehyde dehydrogenase 2 antibody|Aldehyde dehydrogenase 2 family (mitochondrial) antibody|Aldehyde dehydrogenase 2 family antibody|Aldehyde dehydrogenase mitochondrial antibody|Aldehyde dehydrogenase, mitochondrial antibody|ALDH 2 antibody|ALDH class 2 antibody|ALDH E2 antibody|ALDH-E2 antibody|Aldh2 antibody|ALDH2_HUMAN antibody|ALDHI antibody|ALDM antibody|Liver mitochondrial ALDH antibody|MGC1806 antibody|Mitochondrial aldehyde dehydrogenase 2 antibody|MS767 antibody|Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody

ID gène: 217

UniProt: P05091