Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

ATP2A1/SERCA1 anticorps (N-Term)

ATP2A1 Reactivité: Rat, Souris WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043792
  • Antigène Voir toutes ATP2A1/SERCA1 (ATP2A1) Anticorps
    ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
    Épitope
    • 16
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-32, N-Term
    Reactivité
    • 37
    • 30
    • 22
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Rat, Souris
    Hôte
    • 49
    • 5
    Lapin
    Clonalité
    • 47
    • 7
    Polyclonal
    Conjugué
    • 28
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp ATP2A1/SERCA1 est non-conjugé
    Application
    • 40
    • 20
    • 16
    • 14
    • 14
    • 14
    • 13
    • 6
    • 3
    • 3
    • 3
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    MEAAHAKTTE ECLAYFGVSE TTGLTPDQVK RN
    Réactivité croisée (Details)
    Predicted Cross Reactivity: human
    No cross reactivity with other proteins.
    Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
    Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA1 ATPase (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product ATP2A1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
    Autre désignation
    ATP2A1 (ATP2A1 Produits)
    Synonymes
    anticorps cb279, anticorps serca, anticorps serca1, anticorps wu:cegs655, anticorps wu:fb17h11, anticorps wu:fb19b10, anticorps zgc:92110, anticorps ATP2A1, anticorps atp2a, anticorps atp2a2, anticorps atp2b, anticorps ca-p60a, anticorps dar, anticorps serca2, anticorps SERCA1, anticorps ATP2A3, anticorps SERCA1a, anticorps Serca1, anticorps ATP2A, anticorps ATPase, Ca++ transporting, cardiac muscle, fast twitch 1, anticorps ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1, anticorps ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog, anticorps atp2a1, anticorps ATP2A1, anticorps atp2a2.S, anticorps Atp2a1
    Sujet
    SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

    Synonyms: fast twitch skeletal muscle isoform antibody|AT2A1_HUMAN antibody|ATP2A antibody|ATP2A1 antibody|ATPase Ca++ transporting cardiac muscle fast twitch 1 antibody|ATPase Ca++ transporting fast twitch 1 antibody|ATPase, Ca(2+)-transporting fast twitch 1 antibody|Calcium pump 1 antibody|Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform antibody|Calcium-transporting ATPase sarcoplasmic reticulum type antibody|Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody|Fast skeletal muscle SR calcium ATPase antibody|OTTHUMP00000162561 antibody|OTTHUMP00000162562 antibody|Sarcoendoplasmic reticulum calcium ATPase antibody|Sarcoplasmic reticulum Ca(2+)-ATPase 1 antibody|Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 antibody|SERCA 1 antibody|SERCA1 antibody|SERCA1 truncated isoform, included antibody|SR Ca(2+) ATPase 1 antibody|SR Ca(2+)-ATPase 1 antibody
    ID gène
    487
    UniProt
    O14983
    Pathways
    Ribonucleoside Biosynthetic Process
Vous êtes ici:
Support technique