ATP2A1/SERCA1 anticorps (N-Term)
-
- Antigène Voir toutes ATP2A1/SERCA1 (ATP2A1) Anticorps
- ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
-
Épitope
- AA 1-32, N-Term
-
Reactivité
- Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP2A1/SERCA1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- MEAAHAKTTE ECLAYFGVSE TTGLTPDQVK RN
- Réactivité croisée (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Attributs du produit
-
Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA1 ATPase (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ATP2A1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
- Autre désignation
- ATP2A1 (ATP2A1 Produits)
- Synonymes
- anticorps cb279, anticorps serca, anticorps serca1, anticorps wu:cegs655, anticorps wu:fb17h11, anticorps wu:fb19b10, anticorps zgc:92110, anticorps ATP2A1, anticorps atp2a, anticorps atp2a2, anticorps atp2b, anticorps ca-p60a, anticorps dar, anticorps serca2, anticorps SERCA1, anticorps ATP2A3, anticorps SERCA1a, anticorps Serca1, anticorps ATP2A, anticorps ATPase, Ca++ transporting, cardiac muscle, fast twitch 1, anticorps ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1, anticorps ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog, anticorps atp2a1, anticorps ATP2A1, anticorps atp2a2.S, anticorps Atp2a1
- Sujet
-
SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.
Synonyms: fast twitch skeletal muscle isoform antibody|AT2A1_HUMAN antibody|ATP2A antibody|ATP2A1 antibody|ATPase Ca++ transporting cardiac muscle fast twitch 1 antibody|ATPase Ca++ transporting fast twitch 1 antibody|ATPase, Ca(2+)-transporting fast twitch 1 antibody|Calcium pump 1 antibody|Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform antibody|Calcium-transporting ATPase sarcoplasmic reticulum type antibody|Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody|Fast skeletal muscle SR calcium ATPase antibody|OTTHUMP00000162561 antibody|OTTHUMP00000162562 antibody|Sarcoendoplasmic reticulum calcium ATPase antibody|Sarcoplasmic reticulum Ca(2+)-ATPase 1 antibody|Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 antibody|SERCA 1 antibody|SERCA1 antibody|SERCA1 truncated isoform, included antibody|SR Ca(2+) ATPase 1 antibody|SR Ca(2+)-ATPase 1 antibody - ID gène
- 487
- UniProt
- O14983
- Pathways
- Ribonucleoside Biosynthetic Process
-