IKZF1 anticorps (C-Term)

N° du produit ABIN3043860

Détail du produit anti-IKZF1 anticorps

Antigène: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Épitope: AA 428-459, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IKZF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for DNA-binding protein Ikaros(IKZF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: LKEEHRAYDL LRAASENSQD ALRVVSTSGE QM

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for DNA-binding protein Ikaros(IKZF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: IKAROS family zinc finger 1 (Ikaros)
Protein Name: DNA-binding protein Ikaros

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM), different from the related mouse sequence by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur IKZF1

Antigène: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Autre désignation: IKZF1 (IKZF1 Produits)

Synonymes: anticorps Hs.54452, anticorps IK1, anticorps IKAROS, anticorps LYF1, anticorps PRO0758, anticorps ZNFN1A1, anticorps hIk-1, anticorps RGD1562979, anticorps ikaros, anticorps znfn1a1, anticorps ik1, anticorps lyf1, anticorps hik-1, anticorps pro0758, anticorps hs.54452, anticorps MGC108252, anticorps 5832432G11Rik, anticorps Ikaros, anticorps LyF-1, anticorps Zfpn1a1, anticorps Znfn1a1, anticorps hlk-1, anticorps mKIAA4227, anticorps ikzf1, anticorps IKAROS family zinc finger 1, anticorps IKAROS family zinc finger 1 (Ikaros), anticorps IKZF1, anticorps Ikzf1, anticorps ikzf1

Sujet: DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.

Synonyms: CLL associated antigen KW 6 antibody|DNA-binding protein Ikaros antibody|hIk 1 antibody|Hs.54452 antibody|IK1 antibody|Ikaros (zinc finger protein) antibody|IKAROS antibody|IKAROS family zinc finger 1 (Ikaros) antibody|Ikaros family zinc finger protein 1 antibody| Ikzf1 antibody|IKZF1_HUMAN antibody|LYF1 antibody|Lymphoid transcription factor LyF-1 antibody|PRO0758 antibody|Zinc finger protein subfamily 1A 1 (Ikaros) antibody|Zinc finger protein subfamily 1A 1 antibody|Zinc finger protein, subfamily 1A, member 1 antibody| ZNFN1A1 antibody

ID gène: 10320

UniProt: Q13422

Pathways: Production of Molecular Mediator of Immune Response