SOD2 anticorps (C-Term)

N° du produit ABIN3043935

Détail du produit anti-SOD2 anticorps

Antigène: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Épitope: AA 192-222, C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SOD2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Superoxide dismutase [Mn], mitochondrial(SOD2) detection. Tested with WB, IHC-P in Human,Mouse.

Séquence: QYKNVRPDYL KAIWNVINWE NVTERYMACK K

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Superoxide dismutase [Mn], mitochondrial(SOD2) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: superoxide dismutase 2, mitochondrial
Protein Name: Superoxide dismutase [Mn], mitochondrial

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, The detection limit for SOD2 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-SOD2 (ABIN3043935)

Zhang, Deng, Lai, Guan, Sun, Han, Wang, Pan, Ji, Luo, Huang, Tang, Gu, Dan, Yu, Namaka, Zhang, Deng, Li: "Maternal inflammation activated ROS-p38 MAPK predisposes offspring to heart damages caused by isoproterenol via augmenting ROS generation." dans: Scientific reports, Vol. 6, pp. 30146, (2018) (PubMed).

Détails sur SOD2

Antigène: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Autre désignation: SOD2 (SOD2 Produits)

Synonymes: anticorps LOC100101896, anticorps MNSOD, anticorps GB14346, anticorps sod2, anticorps MGC88869, anticorps Sod2, anticorps CG8905, anticorps Dmel\\CG8905, anticorps Mito SOD, anticorps Mn SOD, anticorps Mn-SOD, anticorps Mn-SOD2, anticorps MnSOD, anticorps MnSODII, anticorps Mn[2+]SOD, anticorps SOD, anticorps SOD-2, anticorps SOD2, anticorps Sod-2, anticorps dSOD2, anticorps mitSOD2, anticorps mnSOD, anticorps IPOB, anticorps MVCD6, anticorps cb463, anticorps wu:fj33b01, anticorps zgc:73051, anticorps MnSOD, anticorps manganese superoxide dismutase, anticorps superoxide dismutase 2, mitochondrial, anticorps superoxide dismutase 2, anticorps Mn superoxide dismutase, anticorps Superoxide dismutase 2 (Mn), anticorps superoxide dismutase 2 L homeolog, anticorps BDBG_07234, anticorps LOC100101896, anticorps MNSOD, anticorps Sod2, anticorps sod2, anticorps LbMnSOD4, anticorps SOD2, anticorps LOC100282741, anticorps SOD-2, anticorps sod2.L

Sujet: SOD2(Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.

Synonyms: Indophenoloxidase B antibody|IPO B antibody|IPOB antibody|Manganese containing superoxide dismutase antibody|Manganese SOD antibody|Manganese superoxide dismutase antibody|Mangano superoxide dismutase antibody|Mn SOD antibody|Mn superoxide dismutase antibody|MNSOD antibody|MVCD6 antibody|SOD 2 antibody|SOD-2 antibody|SOD2 antibody|SODM_HUMAN antibody| Superoxide dismutase [Mn] mitochondrial antibody|Superoxide dismutase [Mn] mitochondrial precursor antibody|Superoxide dismutase [Mn], mitochondrial antibody|Superoxide dismutase 2 mitochondrial antibody

ID gène: 6648

UniProt: P04179

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling