TLR5 anticorps (AA 151-181)

N° du produit ABIN342758

Détail du produit anti-TLR5 anticorps

Antigène: TLR5 (Toll-Like Receptor 5 (TLR5))

Épitope: AA 151-181

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA, Immunocytochemistry (ICC), Flow Cytometry (FACS)

Specificité: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR5 and was not tested for cross-reactivity to mouse TLR5.

Homologie: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%) Colobus monkey, Baboon (97%) Marmoset (94%) Sheep, Goat, Panda, Water buffalo (84%) Zebu, Bovine (81%).

Purification: Immunoaffinity purified

Immunogène: Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%), Colobus monkey, Baboon (97%), Marmoset (94%), Sheep, Goat, Panda, Water buffalo (84%), Zebu, Bovine (81%).

Type of Immunogen: Synthetic peptide

Information d'application

Indications d'application: Approved: ELISA (1:35000), Flo (1:50), ICC (1:250), IHC (1:125), WB (1:100)

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid freeze-thaw cycles.

Stock: -20 °C,-80 °C

Stockage commentaire: Short term: -20°C
Long term: -70°C
Avoid freeze-thaw cycles.

Détails sur TLR5

Antigène: TLR5 (Toll-Like Receptor 5 (TLR5))

Autre désignation: TLR5 (TLR5 Produits)

Synonymes: anticorps SLEB1, anticorps TIL3, anticorps TLR-5, anticorps sleb1, anticorps til3, anticorps tlr-5, anticorps tlr5, anticorps toll like receptor 5, anticorps toll-like receptor 5, anticorps toll like receptor 5 L homeolog, anticorps toll-like receptor 5b, anticorps TLR5, anticorps Tlr5, anticorps tlr5.L, anticorps tlr-5, anticorps tlr5b

Sujet: Name/Gene ID: TLR5
Family: Toll-like Receptor

Synonyms: TLR5, TIL3, Toll-like receptor 5, SLEB1

ID gène: 7100

UniProt: O60602

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades