IL22RA2 anticorps (AA 33-60)

N° du produit ABIN342774

Cet anticorps anti-IL22RA2 est un anticorps Chèvre Polyclonal détectant IL22RA2 dans ELISA. Adapté pour Humain et Singe.

Aperçu rapide pour IL22RA2 anticorps (AA 33-60) (ABIN342774)

Antigène: IL22RA2 (Interleukin 22 Receptor, alpha 2 (IL22RA2))

Reactivité: Humain, Singe

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp IL22RA2 est non-conjugé

Application: ELISA

Détail du produit anti-IL22RA2 anticorps

Épitope: AA 33-60

Specificité: This antibody recognizes the N-terminus region of human interleukin-22 receptor alpha-2 chain precursor (IL-22R-alpha-2) which is also known as IL-22-binding protein (IL22BP), cytokine receptor family class II member 10 (CRF2-10), and cytokine receptor family type 2, soluble 1 (CRF2-S1). This antibody is likely to recognize rat and mouse IL-22 RA2 protein due to sequence similarity. The peptide sequence is <50 % identical to other sequences in GenBank.

Homologie: Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%) Gibbon (96%) Marmoset (89%) Dog (82%).

Purification: Immunoaffinity purified

Immunogène: Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%), Gibbon (96%), Marmoset (89%), Dog (82%).

Type of Immunogen: Synthetic peptide

Information d'application

Indications d'application: Approved: ELISA (1:50000)

Usage: ELISA: Peptide-based assay to confirm the ability of the antibody to recognize the immunogenic peptide.

Not recommended for: IHC-P

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: 10  mM KHPO4, 140  mM NaCl, BSA, 0.1 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Aliquot to Avoid freeze/thaw cycles.

Stock: -20 °C

Stockage commentaire: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Détails sur IL22RA2

Antigène: IL22RA2 (Interleukin 22 Receptor, alpha 2 (IL22RA2))

Autre désignation: IL-22BP / IL22RA2

Sujet: Name/Gene ID: IL22RA2

Synonyms: IL22RA2, Class II cytokine receptor, IL-22BP, IL-22RA2, IL-22R-alpha-2, Interleukin 22-binding protein, Interleukin-22-binding protein, CRF2-10, CRF2-S1, CRF2X, IL-22 receptor subunit alpha-2, IL22BP, ZcytoR16

ID gène: 116379

UniProt: Q969J5