TLR10 anticorps (AA 81-111)

N° du produit ABIN342786

Cet anticorps anti-TLR10 est un anticorps Chèvre Polyclonal détectant TLR10 dans WB, IHC et ICC. Adapté pour Humain.

Aperçu rapide pour TLR10 anticorps (AA 81-111) (ABIN342786)

Antigène: TLR10 (Toll-Like Receptor 10 (TLR10))

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR10 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Détail du produit anti-TLR10 anticorps

Épitope: AA 81-111

Specificité: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR10.

Homologie: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%) Orangutan, Monkey (97%) Marmoset (94%) Sheep, Goat, Zebu, Bovine (87%) Elephant, Horse (84%) Panda, Pig (81%).

Purification: Immunoaffinity purified

Immunogène: 31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%), Orangutan, Monkey (97%), Marmoset (94%), Sheep, Goat, Zebu, Bovine (87%), Elephant, Horse (84%), Panda, Pig (81%).

Type of Immunogen: Synthetic peptide

Information d'application

Indications d'application: Approved: ICC (1:200), IHC, WB

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Aliquot to Avoid freeze/thaw cycles.

Stock: -20 °C

Stockage commentaire: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Détails sur TLR10

Antigène: TLR10 (Toll-Like Receptor 10 (TLR10))

Autre désignation: TLR10

Sujet: Name/Gene ID: TLR10
Family: Toll-like Receptor

Synonyms: TLR10, CD290, CD290 antigen, Toll-like receptor 10

ID gène: 81793

UniProt: Q9BXR5

Pathways: Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades