TLR10 anticorps (AA 81-111)
-
- Antigène Voir toutes TLR10 Anticorps
- TLR10 (Toll-Like Receptor 10 (TLR10))
-
Épitope
- AA 81-111
-
Reactivité
- Humain
-
Hôte
- Chèvre
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TLR10 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
- Specificité
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR10.
- Homologie
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%) Orangutan, Monkey (97%) Marmoset (94%) Sheep, Goat, Zebu, Bovine (87%) Elephant, Horse (84%) Panda, Pig (81%).
- Purification
- Immunoaffinity purified
- Immunogène
-
31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%), Orangutan, Monkey (97%), Marmoset (94%), Sheep, Goat, Zebu, Bovine (87%), Elephant, Horse (84%), Panda, Pig (81%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product TLR10 Anticorps primaire
-
anti-Toll-Like Receptor 10 (TLR10) (AA 1-811) antibody
TLR10 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 2A11 unconjugated
anti-Toll-Like Receptor 10 (TLR10) (AA 20-250) antibodyTLR10 Reactivité: Rat WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Toll-Like Receptor 10 (TLR10) (AA 617-784) antibodyTLR10 Reactivité: Humain WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
anti-Toll-Like Receptor 10 (TLR10) (AA 20-474) antibody (PE)TLR10 Reactivité: Humain ICFC Hôte: Souris Monoclonal 3C10C5 PE
-
- Indications d'application
- Approved: ICC (1:200), IHC, WB
- Commentaires
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Aliquot to Avoid freeze/thaw cycles.
- Stock
- -20 °C
- Stockage commentaire
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
-
- Antigène
- TLR10 (Toll-Like Receptor 10 (TLR10))
- Autre désignation
- TLR10 (TLR10 Produits)
- Synonymes
- anticorps TLR10, anticorps CD290, anticorps toll like receptor 10, anticorps toll-like receptor 10, anticorps TLR10, anticorps Tlr10
- Sujet
-
Name/Gene ID: TLR10
Family: Toll-like Receptor
Synonyms: TLR10, CD290, CD290 antigen, Toll-like receptor 10 - ID gène
- 81793
- UniProt
- Q9BXR5
- Pathways
- Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades
-
