ABR anticorps (Middle Region)

N° du produit ABIN4886413

Détail du produit anti-ABR anticorps

Antigène: ABR (Active BCR-Related (ABR))

Épitope: AA 370-407, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Active breakpoint cluster region-related protein(ABR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: HPFPDHELED MKMKISALKS EIQKEKANKG QSRAIERL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Active breakpoint cluster region-related protein(ABR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: active BCR-related
Protein Name: Active breakpoint cluster region-related protein

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407aa HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL), different from the related mouse sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ABR

Antigène: ABR (Active BCR-Related (ABR))

Autre désignation: ABR (ABR Produits)

Synonymes: anticorps MDB, anticorps xabr, anticorps 6330400K15Rik, anticorps AU042359, anticorps active BCR-related, anticorps active BCR-related L homeolog, anticorps active BCR-related gene, anticorps ABR, anticorps abr.L, anticorps Abr

Sujet: This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.

Synonyms: abr | Active BCR related gene | MDB | Q12979

ID gène: 29

UniProt: Q12979

Pathways: Neurotrophin Signaling Pathway, Regulation of Leukocyte Mediated Immunity