ACADVL anticorps (C-Term)

N° du produit ABIN4886415

Détail du produit anti-ACADVL anticorps

Antigène: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Épitope: AA 538-576, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACADVL est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Very long-chain specific acyl-CoA dehydrogenase, mitochondrial(ACADVL) detection. Tested with WB in Human,Rat.

Séquence: RALEQFATVV EAKLIKHKKG IVNEQFLLQR LADGAIDLY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Very long-chain specific acyl-CoA dehydrogenase, mitochondrial(ACADVL) detection. Tested with WB in Human,Rat.
Gene Name: acyl-CoA dehydrogenase, very long chain
Protein Name: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human ACADVL (538-576aa RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ACADVL

Antigène: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Autre désignation: ACADVL (ACADVL Produits)

Synonymes: anticorps ACAD6, anticorps LCACD, anticorps VLCAD, anticorps vlcad, anticorps fb52d04, anticorps wu:fb52d04, anticorps wu:fc75e01, anticorps zgc:64067, anticorps acyl-CoA dehydrogenase very long chain, anticorps acyl-Coenzyme A dehydrogenase, very long chain, anticorps acyl-CoA dehydrogenase, very long chain, anticorps ACADVL, anticorps Acadvl, anticorps acadvl

Sujet: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

Synonyms: ACAD 6 | ACAD6 | Acadvl | LCACD | VLCAD | P49748

ID gène: 37

UniProt: P49748

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process