AMACR anticorps (Middle Region)

N° du produit ABIN4886454

Détail du produit anti-AMACR anticorps

Antigène: AMACR (alpha-Methylacyl-CoA Racemase (AMACR))

Épitope: AA 208-246, Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMACR est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Alpha-methylacyl-CoA racemase(AMACR) detection. Tested with WB in Human,Rat.

Séquence: RGQNMLDGGA PFYTTYRTAD GEFMAVGAIE PQFYELLIK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Alpha-methylacyl-CoA racemase(AMACR) detection. Tested with WB in Human,Rat.
Gene Name: alpha-methylacyl-CoA racemase
Protein Name: Alpha-methylacyl-CoA racemase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK), different from the related mouse and rat sequences by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-AMACR (ABIN4886454)

Wang, Tian, Xiao, Zhang, Sun, Tang: "A metanephric adenoma of the kidney associated with polycythemia: A case report." dans: Oncology letters, Vol. 11, Issue 1, pp. 352-354, (2016) (PubMed).

Détails sur AMACR

Antigène: AMACR (alpha-Methylacyl-CoA Racemase (AMACR))

Autre désignation: AMACR (AMACR Produits)

Synonymes: anticorps AMACR, anticorps DKFZp469O1232, anticorps amacr, anticorps NCU04099.1, anticorps MGC89832, anticorps AMACRD, anticorps CBAS4, anticorps RACE, anticorps RM, anticorps Macr1, anticorps Da1-8, anticorps Marc1, anticorps alpha-methylacyl-CoA racemase, anticorps PROBABLE ALPHA-METHYLACYL-COA RACEMASE MCR (2-methylacyl-CoA racemase) (2-arylpropionyl-CoA epimerase), anticorps Alpha-methylacyl-CoA racemase, anticorps alpha-methylacyl-CoA racemase L homeolog, anticorps AMACR, anticorps mcr, anticorps BPSL0064, anticorps Maqu_2037, anticorps UREG_03852, anticorps MCYG_01809, anticorps amacr, anticorps amacr.L, anticorps MGYG_04259, anticorps NCU04099, anticorps Amacr

Sujet: Alpha-methylacyl-CoA racemase (AMACR) is a mitochondrial and peroxisomal enzyme. It encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.

Synonyms: 2 arylpropionyl CoA epimerase | 2 methylacyl CoA racemase | 2-methylacyl-CoA racemase | Alpha methylacyl CoA racemase | Alpha-methylacyl-CoA racemase | Amacr | CBAS4 | Da1-8 | Macr1 | RACE | RM | Q9UHK6

ID gène: 23600

Pathways: Monocarboxylic Acid Catabolic Process