Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

BCL2L1 anticorps (Middle Region)

BCL2L1 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN4886480
  • Antigène Voir toutes BCL2L1 Anticorps
    BCL2L1 (BCL2-Like 1 (BCL2L1))
    Épitope
    • 29
    • 19
    • 16
    • 16
    • 13
    • 11
    • 11
    • 7
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 75-105, Middle Region
    Reactivité
    • 212
    • 132
    • 115
    • 47
    • 25
    • 11
    • 9
    • 7
    • 5
    • 5
    • 4
    • 2
    • 2
    • 1
    Humain
    Hôte
    • 156
    • 75
    • 2
    Lapin
    Clonalité
    • 145
    • 88
    Polyclonal
    Conjugué
    • 124
    • 24
    • 12
    • 6
    • 6
    • 6
    • 6
    • 6
    • 6
    • 6
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp BCL2L1 est non-conjugé
    Application
    • 161
    • 71
    • 62
    • 58
    • 54
    • 33
    • 32
    • 28
    • 28
    • 21
    • 17
    • 10
    • 7
    • 6
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for Bcl-2-like protein 1(BCL2L1) detection. Tested with WB in Human.
    Séquence
    LDAREVIPMA AVKQALREAG DEFELRYRRA F
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Bcl-2-like protein 1(BCL2L1) detection. Tested with WB in Human.
    Gene Name: BCL2-like 1
    Protein Name: Bcl-2-like protein 1
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product BCL2L1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Cui, Li, Xu, Zhang, Sun, Chen: "Emodin alleviates severe acute pancreatitis-associated acute lung injury by decreasing pre-B-cell colony-enhancing factor expression and promoting polymorphonuclear neutrophil apoptosis." dans: Molecular medicine reports, Vol. 16, Issue 4, pp. 5121-5128, (2018) (PubMed).

    Zhou, Zhang, Li, Hao, Liu, Wang: "Azithromycin synergistically enhances anti-proliferative activity of vincristine in cervical and gastric cancer cells." dans: Cancers, Vol. 4, Issue 4, pp. 1318-32, (2013) (PubMed).

  • Antigène
    BCL2L1 (BCL2-Like 1 (BCL2L1))
    Autre désignation
    BCL2L1 (BCL2L1 Produits)
    Synonymes
    anticorps BCL-XL/S, anticorps BCL2L, anticorps BCLX, anticorps BCLXL, anticorps BCLXS, anticorps Bcl-X, anticorps PPP1R52, anticorps bcl-xL, anticorps bcl-xS, anticorps Bcl(X)L, anticorps Bcl-XL, anticorps Bcl-Xs, anticorps Bcl2l, anticorps BclX, anticorps bcl-x, anticorps Bcl-xl, anticorps Bclx, anticorps bcl-X, anticorps Bcl-xL, anticorps BCL-XL, anticorps BCL2L1, anticorps bcl-XL, anticorps bcl-x(l), anticorps bcl-xl/s, anticorps bcl-xs, anticorps bcl2l, anticorps bclx, anticorps bclxl, anticorps xR11, anticorps bcl-xl, anticorps blp1, anticorps cb1021, anticorps zfBLP1, anticorps BCL2 like 1, anticorps BCL2-like 1, anticorps Bcl2-like 1, anticorps BCL2-like 1 L homeolog, anticorps bcl2-like 1, anticorps BCL2L1, anticorps Bcl2l1, anticorps bcl2l1, anticorps bcl2l1.L
    Sujet
    Bcl-2-like protein 1, also known as Bcl-X, is a protein that in humans is encoded by the BCL2L1 gene. The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform (Bcl-xL) acts as an apoptotic inhibitor and the shorter form (Bcl-xS) acts as an apoptotic activator.

    Synonyms: Apoptosis regulator BclX | Bcl 2 like 1 | Bcl2 like1 | Bcl 2 like 1 protein | Bcl xL | BCL XL/S | Bcl xS | BCL2L | BCL2L1 | Bclx | Q07817
    ID gène
    598
    UniProt
    Q07817
    Pathways
    Apoptose, Negative Regulation of intrinsic apoptotic Signaling
Vous êtes ici:
Support technique