Cnpase anticorps (Middle Region)

N° du produit ABIN4886542

Détail du produit anti-Cnpase anticorps

Antigène: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Épitope: AA 142-178, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cnpase est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for 2',3'-cyclic-nucleotide 3'-phosphodiesterase(CNP) detection. Tested with WB in Human,Mouse,Rat.

Séquence: QYQVVLVEPK TAWRLDCAQL KEKNQWQLSA DDLKKLK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for 2',3'-cyclic-nucleotide 3'-phosphodiesterase(CNP) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: 2',3'-cyclic nucleotide 3' phosphodiesterase
Protein Name: 2',3'-cyclic-nucleotide 3'-phosphodiesterase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human CNPase (142-178aa QYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Cnpase (ABIN4886542)

Cai, Ma, Li, Tian, Li: "Catalpol Protects Pre-Myelinating Oligodendrocytes against Ischemia-induced Oxidative Injury through ERK1/2 Signaling Pathway." dans: International journal of biological sciences, Vol. 12, Issue 12, pp. 1415-1426, (2017) (PubMed).

Détails sur Cnpase

Antigène: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Autre désignation: CNP (CNP Produits)

Synonymes: anticorps CNP1, anticorps CNPase, anticorps Cnp-1, anticorps Cnp1, anticorps CNPF, anticorps CNPI, anticorps CNPII, anticorps CNP, anticorps DKFZp469F1421, anticorps cnpl, anticorps fd21d08, anticorps fi37a10, anticorps rich, anticorps sb:cb662, anticorps si:ch73-158e11.4, anticorps wu:fd21d08, anticorps wu:fd44a05, anticorps wu:fi35d08, anticorps wu:fi37a10, anticorps cnp, anticorps 2',3'-cyclic nucleotide 3' phosphodiesterase, anticorps CNP, anticorps Cnp, anticorps cnp, anticorps cnp.L

Sujet: 2',3'-Cyclic-nucleotide 3'-phosphodiesterase, also known as CNPase, is an enzyme that in humans is encoded by the CNP gene. And this gene is mapped to 17q21.2. CNPase is named for its ability to catalyze the phosphodiester hydrolysis of 2',3'-cyclic nucleotides to 2'-nucleotides. CNPase is thought to play a critical role in the events leading up to myelination. Additionally, CNPase has been demonstrated to inhibit the replication of HIV-1 and other primate lentiviruses by binding the retroviral Gag protein and inhibiting the genesis of nascent viral particles.

Synonyms: CNP 1 | CNP1 | CNP | CNPase | P09543

ID gène: 1267

UniProt: P09543