Fibrinogen beta Chain anticorps (Middle Region)
-
- Antigène Voir toutes Fibrinogen beta Chain (FGB) Anticorps
- Fibrinogen beta Chain (FGB)
-
Épitope
- AA 193-225, Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Fibrinogen beta Chain est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Fibrinogen beta chain (FGB) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- TNLRVLRSIL ENLRSKIQKL ESDVSAQMEY CRT
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Fibrinogen beta chain (FGB) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: fibrinogen beta chain
Protein Name: Fibrinogen beta chain - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product FGB Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- Fibrinogen beta Chain (FGB)
- Autre désignation
- FGB (FGB Produits)
- Synonymes
- anticorps FGB, anticorps 2510049G14Rik, anticorps DKFZp470D0312, anticorps LOC100223598, anticorps fibrinogen, anticorps Ab1-216, anticorps Ac1-581, anticorps wu:fa55c11, anticorps zgc:77116, anticorps fgb, anticorps fibrinogen beta chain, anticorps fibrinogen beta chain L homeolog, anticorps FGB, anticorps Fgb, anticorps fgb, anticorps fgb.L
- Sujet
-
Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Synonyms: FGB | Fibrinogen beta chain | Fibrinopeptide B | HEL S 78p | HEL-S-78p | P02675 - ID gène
- 2244
- UniProt
- P02675
-