GPI anticorps (N-Term)

N° du produit ABIN4886609

Détail du produit anti-GPI anticorps

Antigène: GPI (Glucose-6-Phosphate Isomerase (GPI))

Épitope: AA 2-39, N-Term

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPI est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Mouse.

Séquence: AALTRNPQFQ KLLEWHRANS ANLKLRELFE ADPERFNN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Mouse.
Gene Name: glucose-6-phosphate isomerase
Protein Name: Glucose-6-phosphate isomerase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of mouse GPI (2-39aa AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN), different from the related human sequence by sixteen amino acids, and from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur GPI

Antigène: GPI (Glucose-6-Phosphate Isomerase (GPI))

Autre désignation: GPI (GPI Produits)

Synonymes: anticorps PGI, anticorps Amf, anticorps Gpi1, anticorps GPI, anticorps DDBDRAFT_0185620, anticorps DDBDRAFT_0231026, anticorps DDB_0185620, anticorps DDB_0231026, anticorps CG8251, anticorps Dmel\\CG8251, anticorps Gpi, anticorps pgi, anticorps Gpi-1, anticorps Gpi-1r, anticorps Gpi-1s, anticorps Gpi-1t, anticorps Gpi1-r, anticorps Gpi1-s, anticorps Gpi1-t, anticorps Gpi1s, anticorps MF, anticorps NK, anticorps NK/GPI, anticorps Org, anticorps AMF, anticorps GNPI, anticorps NLK, anticorps PHI, anticorps SA-36, anticorps SA36, anticorps gpi, anticorps pgi-2, anticorps glucose-6-phosphate isomerase, anticorps gpi, anticorps glucose-6-phosphate isomerase 1, anticorps gpi Glucose-6-phosphate isomerase, anticorps Phosphoglucose isomerase, anticorps glucose phosphate isomerase 1, anticorps glucose-6-phosphate isomerase b, anticorps GPI, anticorps Gpi, anticorps gpi, anticorps pgi, anticorps GPI1, anticorps Pgi, anticorps Gpi1, anticorps gpib

Classe de substances: Viral Protein

Sujet: Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

Synonyms: AMF | Aurocrine motility factor | GNPI | GPI | Gpi1 | Neuroleukin | NLK | Oxoisomerase | PGI | PHI | SA36 | SA-36 | SA 36 | P06744

ID gène: 14751

UniProt: P06745