Glucose-6-Phosphate Isomerase (GPI) (AA 2-39), (N-Term) anticorps

Détails pour le produit réf. ABIN4886609
Antigène
  • PGI
  • Amf
  • Gpi1
  • GPI
  • DDBDRAFT_0185620
  • DDBDRAFT_0231026
  • DDB_0185620
  • DDB_0231026
  • CG8251
  • Dmel\\CG8251
  • Gpi
  • pgi
  • Gpi-1
  • Gpi-1r
  • Gpi-1s
  • Gpi-1t
  • Gpi1-r
  • Gpi1-s
  • Gpi1-t
  • Gpi1s
  • MF
  • NK
  • NK/GPI
  • Org
  • AMF
  • GNPI
  • NLK
  • PHI
  • SA-36
  • SA36
  • gpi
  • pgi-2
  • glucose-6-phosphate isomerase
  • gpi
  • glucose-6-phosphate isomerase 1
  • gpi Glucose-6-phosphate isomerase
  • Phosphoglucose isomerase
  • glucose phosphate isomerase 1
  • glucose-6-phosphate isomerase b
  • GPI
  • Gpi
  • gpi
  • pgi
  • GPI1
  • Pgi
  • Gpi1
  • gpib
Épitope
AA 2-39, N-Term
25
15
11
8
8
8
7
7
4
3
3
3
3
2
2
2
1
1
1
1
1
1
Reactivité
Souris
170
74
39
6
5
4
4
4
3
3
2
2
1
Hôte
Lapin
151
44
15
Clonalité
Polyclonal
Conjugué
Inconjugué
16
13
13
6
6
6
3
3
3
3
3
3
1
1
1
1
1
Application
Western Blotting (WB)
169
94
54
33
23
21
15
10
8
8
5
5
2
2
2
2
1
1
Options
Fonction Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Mouse.
Immunogène A synthetic peptide corresponding to a sequence at the N-terminus of mouse GPI (2-39aa AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN), different from the related human sequence by sixteen amino acids, and from the related rat sequence by two amino acids.
Séquence AALTRNPQFQ KLLEWHRANS ANLKLRELFE ADPERFNN
Isotype IgG
Réactivité croisée (Details) No cross reactivity with other proteins.
Attributs du produit Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Mouse.
Gene Name: glucose-6-phosphate isomerase
Protein Name: Glucose-6-phosphate isomerase
Purification Immunogen affinity purified.
Antigène
Autre désignation GPI (GPI Antibody Extrait)
Sujet Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

Synonyms: AMF | Aurocrine motility factor | GNPI | GPI | Gpi1 | Neuroleukin | NLK | Oxoisomerase | PGI | PHI | SA36 | SA-36 | SA 36 | P06744
ID gène 14751
UniProt P06745
Indications d'application WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Commentaires

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Conseil sur la manipulation Avoid repeated freezing and thawing.
Stock 4 °C/-20 °C
Stockage commentaire At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Glucose-6-Phosphate Isomerase (GPI) (AA 2-39), (N-Term) antibody (ABIN4886609) Western blot analysis of GPI expression in mouse thymus extract ( Lane 1). GPI at 64K...
Avez-vous cherché autre chose?