KDM5B anticorps (Middle Region)

N° du produit ABIN4886648

Détail du produit anti-KDM5B anticorps

Antigène: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Épitope: AA 641-685, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KDM5B est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Lysine-specific demethylase 5B(KDM5B) detection. Tested with WB in Human,Mouse,Rat.

Séquence: DVLDVVVAST VQKDMAIMIE DEKALRETVR KLGVIDSERM DFE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Lysine-specific demethylase 5B(KDM5B) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: lysine demethylase 5B
Protein Name: Lysine-specific demethylase 5B

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur KDM5B

Antigène: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Autre désignation: KDM5B (KDM5B Produits)

Synonymes: anticorps jarid1b, anticorps jarid1ba, anticorps id:ibd5050, anticorps wu:fd15c05, anticorps cb264, anticorps jarid1bb, anticorps plu1, anticorps wu:fc44h11, anticorps zgc:85741, anticorps JARID1B, anticorps CT31, anticorps PLU-1, anticorps PLU1, anticorps PUT1, anticorps RBBP2H1A, anticorps 2010009J12Rik, anticorps 2210016I17Rik, anticorps AW556288, anticorps D1Ertd202e, anticorps Jarid1b, anticorps Plu1, anticorps Rb-Bp2, anticorps mKIAA4034, anticorps RGD1565602, anticorps lysine (K)-specific demethylase 5Ba, anticorps lysine (K)-specific demethylase 5Bb, anticorps lysine demethylase 5B, anticorps lysine (K)-specific demethylase 5B, anticorps kdm5ba, anticorps kdm5bb, anticorps KDM5B, anticorps Kdm5b

Sujet: Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.

Synonyms: CT31 | JARID1B | Kdm5b | PLU-1 | PLU1 | PPP1R98 | PUT1 | RBBP2H1A | RBP2-H1 | Q9UGL1

ID gène: 10765

Pathways: L'effet Warburg