YAP1 anticorps (N-Term)

N° du produit ABIN4886772

Détail du produit anti-YAP1 anticorps

Antigène: YAP1 (Yes-Associated Protein 1 (YAP1))

Épitope: AA 62-97, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp YAP1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Transcriptional coactivator YAP1(YAP1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: ETDLEALFNA VMNPKTANVP QTVPMRLRKL PDSFFK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Transcriptional coactivator YAP1(YAP1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Yes associated protein 1
Protein Name: Transcriptional coactivator YAP1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human YAP1 (62-97aa ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur YAP1

Antigène: YAP1 (Yes-Associated Protein 1 (YAP1))

Autre désignation: YAP1 (YAP1 Produits)

Synonymes: anticorps YAP, anticorps YAP2, anticorps YAP65, anticorps YKI, anticorps xyap, anticorps yap, anticorps yap2, anticorps yap65, anticorps yki, anticorps AI325207, anticorps Yap, anticorps Yap65, anticorps Yki, anticorps Yorkie, anticorps cb194, anticorps sb:cb194, anticorps si:ch211-181p1.5, anticorps si:dkey-3b8.3, anticorps wu:fc18c04, anticorps zgc:158380, anticorps Yes associated protein 1, anticorps Yes associated protein 1 S homeolog, anticorps yes-associated protein 1, anticorps Yes-associated protein 1, anticorps YAP1, anticorps yap1.S, anticorps Yap1, anticorps yap1

Sujet: YAP1, also known as YAP or YAP65, is a potent oncogene, which is amplified in various human cancers. This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. It is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Synonyms: YAp 1 | YAp1 | YAP2 | YAP 65 | YAP65 | YKI | Yorkie homolog | P46937

ID gène: 10413

UniProt: P46937

Pathways: Signalisation MAPK, Stem Cell Maintenance, Regulation of Lipid Metabolism by PPARalpha