HSD11B2 anticorps

N° du produit ABIN4951362

Cet anticorps Lapin Polyclonal détecte spécifiquement HSD11B2 dans WB et IHC (p). Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour HSD11B2 anticorps (ABIN4951362)

Antigène: HSD11B2 (Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSD11B2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-HSD11B2 anticorps

Purification: Antigen affinity

Immunogène: Amino acids EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH of human HSD11B2 were used as the immunogen for the HSD11B2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HSD11B2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HSD11B2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HSD11B2

Antigène: HSD11B2 (Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2))

Autre désignation: HSD11B2

Sujet: Corticosteroid 11-β,-dehydrogenase isozyme 2, also known as 11-β,-hydroxysteroid dehydrogenase 2, is an enzyme that in humans is encoded by the HSD11B2 gene. There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.

UniProt: P80365

Pathways: Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones