POR anticorps

N° du produit ABIN4952222

Détail du produit anti-POR anticorps

Antigène: POR (P450 (Cytochrome) Oxidoreductase (POR))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purification: Antigen affinity

Immunogène: Amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK of human Cytochrome P450 Oxidoreductase were used as the immunogen for the POR antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the POR antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the POR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur POR

Antigène: POR (P450 (Cytochrome) Oxidoreductase (POR))

Autre désignation: POR / CYPOR / Cytochrome P450 Oxidoreductase (POR Produits)

Synonymes: anticorps CPR, anticorps CYPOR, anticorps P450R, anticorps POR, anticorps CCR, anticorps CG11567, anticorps DMR, anticorps DmCPR, anticorps Dmel\\CG11567, anticorps NCPR, anticorps P450, anticorps cpr, anticorps zgc:110032, anticorps npr, anticorps xpor, anticorps 4933424M13Rik, anticorps PORCINO, anticorps T5J17.90, anticorps T5J17_90, anticorps TFC C, anticorps TUBULIN-FOLDING COFACTOR C, anticorps cytochrome p450 oxidoreductase, anticorps P450 (cytochrome) oxidoreductase, anticorps ADP-ribosylation factor interacting protein 2, anticorps Cytochrome P450 reductase, anticorps P450 (cytochrome) oxidoreductase a, anticorps P450 (cytochrome) oxidoreductase L homeolog, anticorps NADPH--cytochrome P450 reductase, anticorps C-CAP/cofactor C-like domain-containing protein, anticorps POR, anticorps Arfip2, anticorps Por, anticorps Cpr, anticorps pora, anticorps por.L, anticorps LOC100406157, anticorps por, anticorps LOC100619047

Sujet: POR is a membrane-bound enzyme required for electron transfer from NADPH to Cytochrome p450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal p450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined p450C17 and p450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

UniProt: P16435

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, SARS-CoV-2 Protein Interactome