PPT1 anticorps

N° du produit ABIN4952244

Détail du produit anti-PPT1 anticorps

Antigène: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPT1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purification: Antigen affinity

Immunogène: Amino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PPT1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PPT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PPT1

Antigène: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Autre désignation: PPT1 (PPT1 Produits)

Synonymes: anticorps CLN1, anticorps INCL, anticorps PPT, anticorps 9530043G02Rik, anticorps AA960502, anticorps C77813, anticorps D4Ertd184e, anticorps Ppt, anticorps wu:fj17f04, anticorps zgc:63969, anticorps PPT-1, anticorps ppt1, anticorps palmitoyl-protein thioesterase 1, anticorps Palmitoyl-protein thioesterase 1, anticorps palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile), anticorps palmitoyl-protein thioesterase 1 L homeolog, anticorps PPT1, anticorps MGYG_00692, anticorps Ppt1, anticorps ppt-1, anticorps ppt1, anticorps ppt1.L

Sujet: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

UniProt: P50897

Pathways: SARS-CoV-2 Protein Interactome