PPT1 anticorps

N° du produit ABIN4952244

Cet anticorps Lapin Polyclonal détecte spécifiquement PPT1 dans WB, FACS et IHC (p). Il présente une réactivité avec des échantillons de Humain et Rat.

Aperçu rapide pour PPT1 anticorps (ABIN4952244)

Antigène: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPT1 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-PPT1 anticorps

Fonction: PPT1 Antibody

Séquence: KEDVYRNHSI FLADINQERG INESYKKNLM ALKK

Purification: Antigen affinity

Immunogène: Amino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PPT1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the PPT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur PPT1

Antigène: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Autre désignation: PPT1

Sujet: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

UniProt: P50897

Pathways: SARS-CoV-2 Protein Interactome