SLUG anticorps

N° du produit ABIN4952602

L’anticorps Lapin Polyclonal anti-SLUG a été validé pour WB et IHC (p). Il convient pour détecter SLUG dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour SLUG anticorps (ABIN4952602)

Antigène: SLUG (SNAI2) (Snail Family Zinc Finger 2 (SNAI2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLUG est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-SLUG anticorps

Purification: Antigen affinity

Immunogène: Amino acids KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ of human SLUG were used as the immunogen for the SLUG antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SLUG antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the SLUG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SLUG

Antigène: SLUG (SNAI2) (Snail Family Zinc Finger 2 (SNAI2))

Autre désignation: SLUG / SNAI2

Sujet: SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

UniProt: O43623