Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

TAZ anticorps (Tafazzin) (AA 1-262) Primary Antibody

TAZ Reactivité: Humain ELISA, WB Hôte: Souris Monoclonal 1B10
Pubmed (3)
N° du produit ABIN520708
$440.00
Plus shipping costs $45.00
100 μg
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    Épitope
    AA 1-262
    Reactivité
    Humain
    Hôte
    Souris
    Clonalité
    Monoclonal
    Conjugué
    Cet anticorp TAZ est non-conjugé
    Application
    ELISA, Western Blotting (WB)
    Fonction
    Mouse monoclonal antibody raised against a full length recombinant TAZ.
     Réactivité croisée
    Humain, Rat (Rattus)
    Immunogène

    immunogen: TAZ (AAH11515, 1 a.a. ~ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR

    Clone
    1B10
    Isotype
    IgG2a kappa
  • Indications d'application
    Optimal working dilution should be determined by the investigator.
    Commentaires

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Conseil sur la manipulation
    Aliquot to avoid repeated freezing and thawing.
    Stock
    -20 °C
    Stockage commentaire
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Raghunathan, Dreier, Morgan, Tuyen, Rose, Reilly, Russell, Murphy: "Involvement of YAP, TAZ and HSP90 in contact guidance and intercellular junction formation in corneal epithelial cells." dans: PLoS ONE, Vol. 9, Issue 10, pp. e109811, 2014 (PubMed).

    Raghunathan, Morgan, Dreier, Reilly, Thomasy, Wood, Ly, Tuyen, Hughbanks, Murphy, Russell: "Role of substratum stiffness in modulating genes associated with extracellular matrix and mechanotransducers YAP and TAZ." dans: Investigative ophthalmology & visual science, Vol. 54, Issue 1, pp. 378-86, 2013 (PubMed).

    Thomasy, Morgan, Wood, Murphy, Russell: "Substratum stiffness and latrunculin B modulate the gene expression of the mechanotransducers YAP and TAZ in human trabecular meshwork cells." dans: Experimental eye research, Vol. 113, pp. 66-73, 2013 (PubMed).

  • Antigène
    Autre désignation
    TAZ (TAZ Antibody Extrait)
    Sujet
    Full Gene Name: tafazzin
    Synonyms: BTHS,CMD3A,EFE,EFE2,FLJ27390,G4.5,LVNCX,Taz1,XAP-2
    ID gène
    6901
Vous êtes ici: