ANGPTL4 anticorps (C-Term)

N° du produit ABIN5518734

Détail du produit anti-ANGPTL4 anticorps

Antigène: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Épitope: AA 369-406, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANGPTL4 est non-conjugé

Application: Western Blotting (WB), ELISA

Fonction: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 4(ANGPTL4) detection. Tested with WB, ELISA in Human.

Séquence: QQRQKLKKGI FWKTWRGRYY PLQATTMLIQ PMAAEAAS

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 4(ANGPTL4) detection. Tested with WB, ELISA in Human.
Gene Name: angiopoietin-like 4
Protein Name: Angiopoietin-related protein 4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human ANGPTL4 (369-406aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ANGPTL4

Antigène: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Autre désignation: ANGPTL4 (ANGPTL4 Produits)

Synonymes: anticorps ANGPTL2, anticorps ARP4, anticorps FIAF, anticorps HFARP, anticorps NL2, anticorps PGAR, anticorps pp1158, anticorps Arp4, anticorps Bk89, anticorps Fiaf, anticorps Hfarp, anticorps Ng27, anticorps Pgar, anticorps Pgarg, anticorps Pp1158, anticorps ANGPTL4, anticorps fiaf, anticorps im:7144703, anticorps si:rp71-39b20.7, anticorps angiopoietin like 4, anticorps angiopoietin-like 4, anticorps ANGPTL4, anticorps Angptl4, anticorps angptl4

Sujet: Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.

Synonyms: Angiopoietin like 4 | Angiopoietin related protein 4 | Angiopoietinlike 4 | angiopoietin-like 4 | Angiopoietin-like 4 | Angiopoietin-like protein 4 | Angiopoietinrelated protein 4 | ANGL4 | angptl 4 | ANGPTL2 | ANGPTL4 | ARP4 | PGAR | HFARP | pp1158 | PSEC0166 | TGQTL | Q9BY76

ID gène: 51129

Pathways: Regulation of Lipid Metabolism by PPARalpha