Annexin VIII anticorps (N-Term)

N° du produit ABIN5518736

Détail du produit anti-Annexin VIII anticorps

Antigène: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Épitope: AA 20-61, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin VIII est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Annexin A8(ANXA8) detection. Tested with WB in Human.

Séquence: HFNPDPDAET LYKAMKGIGT NEQAIIDVLT KRSNTQRQQI AK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Annexin A8(ANXA8) detection. Tested with WB in Human.
Gene Name: annexin A8
Protein Name: Annexin A8

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Annexin VIII (ABIN5518736)

Salenius, Haapanen, Harju, Jokela, Riekkinen: "Late carotid restenosis: aetiologic factors for recurrent carotid artery stenosis during long-term follow-up." dans: European journal of vascular surgery, Vol. 3, Issue 3, pp. 271-7, (1989) (PubMed).

Détails sur Annexin VIII

Antigène: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Autre désignation: ANXA8 (ANXA8 Produits)

Synonymes: anticorps ANX8, anticorps ANXA8L1, anticorps ANXA8L2, anticorps AI466995, anticorps Anx8, anticorps anx8, anticorps MGC85309, anticorps ANXA8, anticorps annexin A8, anticorps annexin A8 S homeolog, anticorps ANXA8, anticorps Anxa8, anticorps anxa8.S, anticorps LOC694628, anticorps LOC100052045

Sujet: ANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Synonyms: Annexin-8 | AnnexinVIII | ANX8 | ANXA8 | P13928 | VAC-beta | Vascular anticoagulant-beta | Annexin VIII

ID gène: 653145

UniProt: P13928