Annexin IV anticorps (Middle Region)

N° du produit ABIN5518805

Détail du produit anti-Annexin IV anticorps

Antigène: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Épitope: AA 119-152, Middle Region

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin IV est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Annexin A4(ANXA4) detection. Tested with WB in Human,Mouse,Rat.

Séquence: EEIRRISQTY QQQYGRSLED DIRSDTSFMF QRVL

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Annexin A4(ANXA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: annexin A4
Protein Name: Annexin A4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Annexin IV (ABIN5518805)

Manville, Abbott: "Ancient and modern anticonvulsants act synergistically in a KCNQ potassium channel binding pocket." dans: Nature communications, Vol. 9, Issue 1, pp. 3845, (2018) (PubMed).

Détails sur Annexin IV

Antigène: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Autre désignation: ANXA4 (ANXA4 Produits)

Synonymes: anticorps ANXA4, anticorps Anx4, anticorps XAnx4, anticorps pig28, anticorps X-anx4, anticorps Xanx-4, anticorps ANXIV, anticorps anx4, anticorps ANX4, anticorps PIG28, anticorps ZAP36, anticorps Annexin-4, anticorps P32.5, anticorps PAP-II, anticorps PP4-X, anticorps AI265406, anticorps AIV, anticorps AW106930, anticorps annexin A4, anticorps annexin A4 L homeolog, anticorps ANXA4, anticorps anxa4, anticorps CC1G_00713, anticorps LOC100280951, anticorps Anxa4, anticorps anxa4.L

Sujet: ANXA4 (Annexin A4), also known as ANX4, is a protein that in humans is encoded by the ANXA4 gene. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. By PCR analysis of somatic cell hybrids and in situ hybridization with a cDNA probe, the human ANXA4 gene is mapped to chromosome 2p13. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. And ANXA4 is almost exclusively expressed in epithelial cells.

Synonyms: Annexin A4 | 35-beta calcimedin | Annexin IV | Annexin-4 | Carbohydrate-binding protein p33/p41 | Chromobindin-4 | Endonexin I | Lipocortin IV | P32.5 | PP4-X | Placental anticoagulant protein II | PAP-II | Protein II | ANXA4 | ANX4 | P09525

ID gène: 307

UniProt: P09525