MAK anticorps (C-Term)

N° du produit ABIN5518933

Détail du produit anti-MAK anticorps

Antigène: MAK (Male Germ Cell-Associated Kinase (MAK))

Épitope: AA 588-623, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAK est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase MAK(MAK) detection. Tested with WB in Human.

Séquence: RTYNPTAKNL NIVNRAQPIP SVHGRTDWVA KYGGHR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase MAK(MAK) detection. Tested with WB in Human.
Gene Name: male germ cell associated kinase
Protein Name: Serine/threonine-protein kinase MAK

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human MAK (588-623aa RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur MAK

Antigène: MAK (Male Germ Cell-Associated Kinase (MAK))

Autre désignation: MAK (MAK Produits)

Synonymes: anticorps RP62, anticorps dJ417M14.2, anticorps A930010O05Rik, anticorps Ick, anticorps fj04c02, anticorps wu:fj04c02, anticorps zgc:56603, anticorps rp62, anticorps xmak, anticorps MGC82717, anticorps MGC146434, anticorps male germ cell associated kinase, anticorps male germ cell-associated kinase, anticorps male germ cell associated kinase L homeolog, anticorps MAK, anticorps Mak, anticorps mak, anticorps mak.L

Sujet: Serine/threonine-protein kinase MAK is an enzyme that in humans is encoded by the MAK gene. The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62.

Synonyms: Serine/threonine-protein kinase MAK

ID gène: 4117

UniProt: P20794