SRY anticorps (Middle Region)

N° du produit ABIN5518959

Détail du produit anti-SRY anticorps

Antigène: SRY (Sex Determining Region Y (SRY))

Épitope: AA 90-130, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRY est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Sex-determining region Y protein(SRY) detection. Tested with WB in Human.

Séquence: ISKQLGYQWK MLTEAEKWPF FQEAQKLQAM HREKYPNYKY R

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Sex-determining region Y protein(SRY) detection. Tested with WB in Human.
Gene Name: sex determining region Y
Protein Name: Sex-determining region Y protein

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SRY

Antigène: SRY (Sex Determining Region Y (SRY))

Autre désignation: SRY (SRY Produits)

Synonymes: anticorps SRXX1, anticorps SRXY1, anticorps TDF, anticorps TDY, anticorps SRYGENE, anticorps Sry1, anticorps Sry3BI, anticorps Tdf, anticorps Tdy, anticorps SRY, anticorps sex determining region Y, anticorps sex determining region of Chr Y, anticorps SRY, anticorps Sry

Sujet: This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome), translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.

Synonyms: Sex-determining region Y protein, Testis-determining factor, SRY, TDF

ID gène: 6736

UniProt: Q05066