MPP1 anticorps (AA 409-450)

N° du produit ABIN5646989

Détail du produit anti-MPP1 anticorps

Antigène: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Épitope: AA 409-450

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 409-450 (TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF) from the human protein were used as the immunogen for the MPP1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MPP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur MPP1

Antigène: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Autre désignation: MPP1 (MPP1 Produits)

Synonymes: anticorps AAG12, anticorps DXS552E, anticorps EMP55, anticorps MRG1, anticorps PEMP, anticorps MGC53500, anticorps MGC89895, anticorps MPP1, anticorps p55, anticorps cb997, anticorps zgc:77039, anticorps wu:fc85f03, anticorps 55kDa, anticorps C130070C03Rik, anticorps membrane palmitoylated protein 1, anticorps membrane protein, palmitoylated 1 L homeolog, anticorps membrane protein, palmitoylated 1, anticorps membrane protein, palmitoylated, anticorps MPP1, anticorps mpp1.L, anticorps mpp1, anticorps Mpp1

Sujet: Membrane Palmitoylated Protein 1, also called '55 kDa erythrocyte membrane protein,' is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q00013