Iba1 anticorps (AA 99-133)

N° du produit ABIN5647006

L’anticorps Lapin Polyclonal anti-Iba1 a été validé pour WB et IHC (p). Il convient pour détecter Iba1 dans des échantillons de Humain.

Aperçu rapide pour Iba1 anticorps (AA 99-133) (ABIN5647006)

Antigène: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Iba1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-Iba1 anticorps

Épitope: AA 99-133

Purification: Antigen affinity purified

Immunogène: Amino acids 99-133 (ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK) from the human protein were used as the immunogen for the IBA1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IBA1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the IBA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Iba1

Antigène: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Autre désignation: IBA1 / AIF-1

Sujet: Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1 (IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.

UniProt: P55008

Pathways: Smooth Muscle Cell Migration