HNRNPA1 anticorps (AA 8-42)

N° du produit ABIN5647145

Cet anticorps anti-HNRNPA1 Polyclonal Lapin (ABIN5647145) détecte spécifiquement HNRNPA1 dans WB, IF, IHC (p) et FACS. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour HNRNPA1 anticorps (AA 8-42) (ABIN5647145)

Antigène: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPA1 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Détail du produit anti-HNRNPA1 anticorps

Épitope: AA 8-42

Fonction: hnRNP A1 Antibody

Séquence: KEPEQLRKLF IGGLSFETTD ESLRSHFEQW GTLTD

Purification: Antigen affinity

Immunogène: Amino acids 8-42 (KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD) were used as the immunogen for the hnRNP A1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the hnRNP A1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the hnRNP A1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur HNRNPA1

Antigène: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Autre désignation: hnRNP A1

Sujet: Heterogeneous nuclear ribonucleoprotein A1 is a protein that in humans is encoded by the HNRNPA1 gene. This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.

ID gène: 3178

UniProt: P09651