RANBP2 anticorps (AA 3018-3057)

N° du produit ABIN5647220

Cet anticorps anti-RANBP2 est un anticorps Lapin Polyclonal détectant RANBP2 dans WB. Adapté pour Souris et Rat.

Aperçu rapide pour RANBP2 anticorps (AA 3018-3057) (ABIN5647220)

Antigène: RANBP2 (RAN Binding Protein 2 (RANBP2))

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RANBP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RANBP2 anticorps

Épitope: AA 3018-3057

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids 3018-3057 (EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE) were used as the immunogen for the RanBP2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the RanBP2 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the RanBP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur RANBP2

Antigène: RANBP2 (RAN Binding Protein 2 (RANBP2))

Autre désignation: RanBP2

Sujet: RAN binding protein 2 (RANBP2), also called NUP358 is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q.

UniProt: P49792

Pathways: Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus