RANBP2 anticorps (AA 3018-3057)

N° du produit ABIN5647220

Détail du produit anti-RANBP2 anticorps

Antigène: RANBP2 (RAN Binding Protein 2 (RANBP2))

Épitope: AA 3018-3057

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RANBP2 est non-conjugé

Application: Western Blotting (WB)

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids 3018-3057 (EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE) were used as the immunogen for the RanBP2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the RanBP2 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the RanBP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur RANBP2

Antigène: RANBP2 (RAN Binding Protein 2 (RANBP2))

Autre désignation: RanBP2 (RANBP2 Produits)

Synonymes: anticorps ANE1, anticorps IIAE3, anticorps NUP358, anticorps TRP1, anticorps TRP2, anticorps A430087B05Rik, anticorps AI256741, anticorps RGD1560047, anticorps RANBP2, anticorps ane1, anticorps nup358, anticorps trp1, anticorps trp2, anticorps RAN binding protein 2, anticorps E3 SUMO-protein ligase RanBP2, anticorps RANBP2, anticorps Ranbp2, anticorps LOC474539, anticorps ranbp2, anticorps LOC100511376

Sujet: RAN binding protein 2 (RANBP2), also called NUP358 is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q.

UniProt: P49792

Pathways: Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus