PIAS4 anticorps (AA 130-174)

N° du produit ABIN5647228

L’anticorps anti-PIAS4 Polyclonal Lapin est utilisé pour la détection de PIAS4 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour PIAS4 anticorps (AA 130-174) (ABIN5647228)

Antigène: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIAS4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIAS4 anticorps

Épitope: AA 130-174

Purification: Antigen affinity purified

Immunogène: Amino acids 130-174 (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE) from the human protein were used as the immunogen for the PIAS4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PIAS4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PIAS4

Antigène: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Autre désignation: PIAS4 / PIASg

Sujet: Protein inhibitor of activated STAT protein 4 or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.

UniProt: Q8N2W9

Pathways: Signalistation JAK/STAT, Interferon-gamma Pathway, Positive Regulation of Response to DNA Damage Stimulus