HTRA3 anticorps (AA 330-362)

N° du produit ABIN5647345

L’anticorps Lapin Polyclonal anti-HTRA3 a été validé pour WB. Il convient pour détecter HTRA3 dans des échantillons de Humain.

Aperçu rapide pour HTRA3 anticorps (AA 330-362) (ABIN5647345)

Antigène: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HTRA3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HTRA3 anticorps

Épitope: AA 330-362

Purification: Antigen affinity purified

Immunogène: Amino acids 330-362 (FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR) from the human protein were used as the immunogen for the HtrA3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HtrA3 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HtrA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HTRA3

Antigène: HTRA3 (HtrA Serine Peptidase 3 (HTRA3))

Autre désignation: HtrA3

Sujet: Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.

UniProt: P83110