PPARG anticorps (AA 207-248)

N° du produit ABIN5647376

Cet anticorps anti-PPARG Polyclonal Lapin (ABIN5647376) détecte spécifiquement PPARG dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PPARG anticorps (AA 207-248) (ABIN5647376)

Antigène: PPARG (Peroxisome Proliferator-Activated Receptor gamma (PPARG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPARG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PPARG anticorps

Épitope: AA 207-248

Fonction: PPAR gamma Antibody (Middle Region)

Séquence: AIRFGRMPQA EKEKLLAEIS SDIDQLNPES ADLRALAKHL YD

Purification: Antigen affinity

Immunogène: Amino acids 207-248 (AIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYD) were used as the immunogen for the PPAR gamma antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PPAR gamma antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the PPAR gamma antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur PPARG

Antigène: PPARG (Peroxisome Proliferator-Activated Receptor gamma (PPARG))

Autre désignation: PPAR gamma

Sujet: The peroxisome proliferator-activated receptors (PPARs) are a group of three nuclear receptor isoforms, PPAR gamma, PPAR alpha, and PPAR delta, encoded by different genes. PPARs are ligand-regulated transcription factors that control gene expression by binding to specific response elements (PPREs) within promoters. PPAR gamma is a transcription factor that has a pivotal role in adipocyte differentiation and expression of adipocyte-specific genes. The PPAR gamma1 and gamma2 isoforms result from alternative splicing and have ligand-dependent and -independent activation domains. PPAR gamma is a member of a family of nuclear receptors/ligand-dependent transcription factors, which bind to hormone response elements on target gene promoters. PPAR gamma is abundantly expressed in normal lung tissues, especially in endothelial cells, but that its expression is reduced or absent in the angiogenic plexiform lesions of pulmonary hypertensive lungs and in the vascular lesions of a rat model of severe pulmonary hypertension. And it is concluded that fluid shear stress decreases the expression of PPARgamma in endothelial cells and that loss of PPARgamma expression characterizes an abnormal, proliferating, apoptosis-resistant endothelial cell phenotype.

UniProt: P37231

Pathways: Signalisation MAPK, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Endopeptidase Activity, Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation