NOS2 anticorps (AA 1088-1126)

N° du produit ABIN5647389

Cet anticorps Lapin Polyclonal détecte spécifiquement NOS2 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour NOS2 anticorps (AA 1088-1126) (ABIN5647389)

Antigène: NOS2 (Nitric Oxide Synthase 2, Inducible (NOS2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NOS2 anticorps

Épitope: AA 1088-1126

Purification: Antigen affinity purified

Immunogène: Amino acids 1088-1126 (ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED) from the human protein were used as the immunogen for the iNOS antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the iNOS antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the iNOS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur NOS2

Antigène: NOS2 (Nitric Oxide Synthase 2, Inducible (NOS2))

Autre désignation: iNOS / NOS2

Sujet: Nitric oxide synthase, inducible is an enzyme that in humans is encoded by the NOS2 gene. Nitric oxide (NO) is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter, it is implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. Three different NOS isoforms have been identified which fall into two distinct types, constitutive and inducible. The inducible NOS (iNOS) isoform is expressed in a variety of cell types and tissues in response to inflammatory agents and cytokines. The human iNOS (NOS2) gene is approximately 37 kb in length and consists of 26 exons and 25 introns. NOS2-derived NO is a prerequisite for cytokine signaling and function in innate immunity.

UniProt: P35228

Pathways: Retinoic Acid Receptor Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Inositol Metabolic Process, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process