ANGPTL4 anticorps (AA 369-406)

N° du produit ABIN5647464

Cet anticorps Lapin Polyclonal détecte spécifiquement ANGPTL4 dans WB et ELISA. Il présente une réactivité envers Humain.

Aperçu rapide pour ANGPTL4 anticorps (AA 369-406) (ABIN5647464)

Antigène: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANGPTL4 est non-conjugé

Application: Western Blotting (WB), ELISA

Détail du produit anti-ANGPTL4 anticorps

Épitope: AA 369-406

Purification: Antigen affinity purified

Immunogène: Amino acids 369-406 (QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS) from the human protein were used as the immunogen for the ANGPTL4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ANGPTL4 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,ELISA: 0.1-0.5 μg/mL (human protein tested, request BSA-free format for coating)

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ANGPTL4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ANGPTL4

Antigène: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Autre désignation: ANGPTL4

Sujet: Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.

UniProt: Q9BY76

Pathways: Regulation of Lipid Metabolism by PPARalpha