APC2 anticorps (AA 51-90)

N° du produit ABIN5647467

Détail du produit anti-APC2 anticorps

Antigène: APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))

Épitope: AA 51-90

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APC2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the APC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur APC2

Antigène: APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))

Autre désignation: APC2 (APC2 Produits)

Synonymes: anticorps APCL, anticorps AI852447, anticorps R75424, anticorps APC2, WNT signaling pathway regulator, anticorps adenomatosis polyposis coli 2, anticorps APC2, anticorps Apc2

Sujet: APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.

UniProt: O95996

Pathways: Signalisation WNT