CCDC6 anticorps (AA 156-198)

N° du produit ABIN5647505

Cet anticorps anti-CCDC6 Polyclonal Lapin (ABIN5647505) détecte spécifiquement CCDC6 dans WB. L’anticorps est réactif avec des échantillons de Humain et Rat.

Aperçu rapide pour CCDC6 anticorps (AA 156-198) (ABIN5647505)

Antigène: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CCDC6 anticorps

Épitope: AA 156-198

Fonction: CCDC6 Antibody

Séquence: KAELEQHLEQ EQEFQVNKLM KKIKKLENDT ISKQLTLEQL RRE

Purification: Antigen affinity

Immunogène: Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody.

Isotype: IgG

Information d'application

Indications d'application: Differences in protocols and secondary/substrate sensitivity may require the CCDC6 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the CCDC6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur CCDC6

Antigène: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Autre désignation: CCDC6

Sujet: Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

UniProt: Q16204