CCDC6 anticorps (AA 156-198)

N° du produit ABIN5647505

Détail du produit anti-CCDC6 anticorps

Antigène: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Épitope: AA 156-198

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC6 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CCDC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CCDC6

Antigène: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Autre désignation: CCDC6 (CCDC6 Produits)

Synonymes: anticorps ccdc6, anticorps fj36e04, anticorps zgc:56563, anticorps zgc:77435, anticorps wu:fj36e04, anticorps MGC53501, anticorps D10S170, anticorps H4, anticorps PTC, anticorps TPC, anticorps TST1, anticorps 2810012H18Rik, anticorps AA536681, anticorps AA960498, anticorps AW061011, anticorps coiled-coil domain containing 6a, anticorps coiled-coil domain containing 6 S homeolog, anticorps coiled-coil domain containing 6, anticorps ccdc6a, anticorps ccdc6.S, anticorps CCDC6, anticorps Ccdc6

Sujet: Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

UniProt: Q16204