GPI anticorps (AA 2-39)

N° du produit ABIN5647568

Cet anticorps anti-GPI est un anticorps Lapin Polyclonal détectant GPI dans WB. Adapté pour Souris.

Aperçu rapide pour GPI anticorps (AA 2-39) (ABIN5647568)

Antigène: GPI (Glucose-6-Phosphate Isomerase (GPI))

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPI est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GPI anticorps

Épitope: AA 2-39

Purification: Antigen affinity purified

Immunogène: Amino acids 2-39 (AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN) from the mouse protein were used as the immunogen for the Glucose-6-phosphate isomerase antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Glucose-6-phosphate isomerase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur GPI

Antigène: GPI (Glucose-6-Phosphate Isomerase (GPI))

Autre désignation: GPI / Glucose-6-phosphate isomerase

Sujet: Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase (PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

UniProt: P06745