HCN2 anticorps (AA 682-714)

N° du produit ABIN5647571

Cet anticorps anti-HCN2 est un anticorps Lapin Polyclonal détectant HCN2 dans WB et IHC (p). Adapté pour Rat et Souris.

Aperçu rapide pour HCN2 anticorps (AA 682-714) (ABIN5647571)

Antigène: HCN2 (Hyperpolarization Activated Cyclic Nucleotide-Gated Potassium Channel 2 (HCN2))

Reactivité: Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HCN2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-HCN2 anticorps

Épitope: AA 682-714

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids 682-714 (VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF) from the human protein were used as the immunogen for the HCN2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HCN2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HCN2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HCN2

Antigène: HCN2 (Hyperpolarization Activated Cyclic Nucleotide-Gated Potassium Channel 2 (HCN2))

Autre désignation: HCN2

Sujet: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated ion channel 2 is a protein that in humans is encoded by the HCN2 gene. The HCN2 gene is localized on human chromosome 19p13.3 and contains eight exons spanning approximately 27 kb. Hyperpolarization-activated cation channels of the HCN gene family, such as HCN2, contribute to spontaneous rhythmic activity in both heart and brain.

UniProt: Q9UL51