MAK anticorps (AA 588-623)

N° du produit ABIN5647592

Détail du produit anti-MAK anticorps

Antigène: MAK (Male Germ Cell-Associated Kinase (MAK))

Épitope: AA 588-623

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAK est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 588-623 (RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR) were used as the immunogen for the MAK antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MAK antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MAK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur MAK

Antigène: MAK (Male Germ Cell-Associated Kinase (MAK))

Autre désignation: MAK / Male germ cell-associated kinase (MAK Produits)

Synonymes: anticorps RP62, anticorps dJ417M14.2, anticorps A930010O05Rik, anticorps Ick, anticorps fj04c02, anticorps wu:fj04c02, anticorps zgc:56603, anticorps rp62, anticorps xmak, anticorps MGC82717, anticorps MGC146434, anticorps male germ cell associated kinase, anticorps male germ cell-associated kinase, anticorps male germ cell associated kinase L homeolog, anticorps MAK, anticorps Mak, anticorps mak, anticorps mak.L

Sujet: Serine/threonine-protein kinase MAK (Male germ cell-associated kinase) is an enzyme that in humans is encoded by the MAK gene. The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62.

UniProt: P20794