ASXL1 anticorps

N° du produit ABIN5647693

L’anticorps Lapin Polyclonal anti-ASXL1 a été validé pour WB. Il convient pour détecter ASXL1 dans des échantillons de Humain et Souris.

Aperçu rapide pour ASXL1 anticorps (ABIN5647693)

Antigène: ASXL1 (Additional Sex Combs Like 1 (ASXL1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASXL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ASXL1 anticorps

Purification: Antigen affinity purified

Immunogène: Amino acids KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE were used as the immunogen for the ASXL1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ASXL1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ASXL1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ASXL1

Antigène: ASXL1 (Additional Sex Combs Like 1 (ASXL1))

Autre désignation: ASXL1

Sujet: Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.

UniProt: Q8IXJ9

Pathways: Retinoic Acid Receptor Signaling Pathway